General Information

  • ID:  hor004609
  • Uniprot ID:  Q566V9
  • Protein name:  Augurin-A
  • Gene name:  ecrg4a
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  Augurin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  causes severe defects in the development of the central nervous system, including enlarged hindbrain ventricles resembling a brain ventricular hydrocephalus-like edema phenotype
  • Taxonomy:  Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0007417 central nervous system development; GO:0008285 negative regulation of cell population proliferation; GO:0009611 response to wounding; GO:0031145 anaphase-promoting complex-dependent catabolic process; GO:0042127 regulation of cell population proliferation; GO:0070314 G1 to G0 transition; GO:0090398 cellular senescence
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016324 apical plasma membrane

Sequence Information

  • Sequence:  NLWDRSRPDVQQWIQQFMYMGFDEARLETDLAYWMDQHRSSDQGRQHHYDENAALGPR
  • Length:  58(69-126)
  • Propeptide:  MLSEKFHLRLLTLLTLLTALSLTDVASESKLEKLLMKRVDRDVKPAAAVAVSPSKAKEFLTSLKRPKRNLWDRSRPDVQQWIQQFMYMGFDEARLETDLAYWMDQHRSSDQGRQHHYDENAALGPRGAASYRHGANVNYDYY
  • Signal peptide:  MLSEKFHLRLLTLLTLLTALSLTDVASE
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Required for the proper formation of the central nervous system by attenuating cell proliferation during development
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q566V9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004609_AF2.pdbhor004609_ESM.pdb

Physical Information

Mass: 811463 Formula: C309H450N94O95S3
Absent amino acids: CK Common amino acids: DQR
pI: 4.91 Basic residues: 9
Polar residues: 12 Hydrophobic residues: 15
Hydrophobicity: -128.97 Boman Index: -19152
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 45.52
Instability Index: 7152.59 Extinction Coefficient cystines: 20970
Absorbance 280nm: 367.89

Literature

  • PubMed ID:  NA
  • Title:  NA